PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10030482m
Common NameCICLE_v10030482mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB
Protein Properties Length: 1765aa    MW: 192419 Da    PI: 6.3693
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10030482mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.92.8e-09825866346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e++vd  + +G++ +++Ia+ ++  +t  +c+++++k
  Ciclev10030482m 825 PWTSEEREIFVDKLATFGKD-FRKIASFLN-YKTTADCVEFYYK 866
                      8*****************99.*********.9**********98 PP

2Myb_DNA-binding35.81.9e-1110411081345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                        WT eE  ++++av+ +G++ ++ Iar++  +R++ qck ++ 
  Ciclev10030482m 1041 DWTDEEKSIFIQAVTSYGKD-FSMIARCIR-TRSRDQCKVFFS 1081
                       6*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.72E-13809869IPR009057Homeodomain-like
PROSITE profilePS5129315.167821872IPR017884SANT domain
SMARTSM007172.4E-9822870IPR001005SANT/Myb domain
PfamPF002491.2E-6824866IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-5825871IPR009057Homeodomain-like
PROSITE profilePS5129311.5910371088IPR017884SANT domain
SMARTSM007171.6E-810381086IPR001005SANT/Myb domain
SuperFamilySSF466895.23E-1110391088IPR009057Homeodomain-like
PfamPF002497.0E-810411081IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-710411082IPR009057Homeodomain-like
CDDcd001671.46E-710421080No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1765 aa     Download sequence    Send to blast
MPPEPLPSDR KDFFKERKHH NNNSSHHQTD RSSSESLLGG GGNGGGGSLH RWRDYSHHGR  60
EYPRFGSADF RRPPGHGKQG GCHIFAEESG HGYAPYRSSD KMPEDESTRI SVSRGDGKYG  120
RNSRENRSSF CQSDCKGYAW DTSNGYATTP GRLHEVNCNQ RSVDDMLTYP SHPQSDFVTW  180
DHLQLKDQHD NKIGSVNGLA TGQRCESENS LDWKKIKWTR SGSLSSRGSG LSHSSSSKSM  240
GGVDSSEGKT DFQVKNATSI QSPSGDAATY ATSGVLFEET TSRKKPRLGW GEGLAKYEKK  300
KVEVPDVSGN KDGVFNFSSN AEPLQSLSSN LAEKSPRVMG FSDCASPATP SSVACSSSPG  360
VEEKAFGKAV SVDNDVSNLC GSPSIVSQNH REGFLFNLEK LDTNSIGNLG SSLVELLQYD  420
DPSSVDSSFV RSTAMNKLLV WKGDILKTLE MTETEIDSLE NELKSLKSVL GSTSPCPVTS  480
ISLSVEDNAN PFNKQGTVSN SIIRPAPLQI DCGDLSVERM PDCGHGLEEV HGNSKDEDID  540
SPGTATSKFV EPSSFVKPVS PSNMLKNGES FGVLDTVHSS NTEVKCTMPG SSFGEVVAGA  600
STCGDGDMIL ESKNDALISS NFSAYADGEN MLCDMILGAN KELANEASEV LKKLLPRDHS  660
NIDISGVANV FCCQNDSLVK EKFAKKKQLL RFKERVLTLK FKAFQHLWRE DLRLLSIRKY  720
RARSQKKCEL SLRTTYTGYQ KHRSSIRSRF SSPAAGNLSL VQTAEVINFT SKLLSDSQIK  780
TYRNSLKMPA LILDKKEKMS SRFISSNGLV EDPCAVEKER AMINPWTSEE REIFVDKLAT  840
FGKDFRKIAS FLNYKTTADC VEFYYKNHKS DCFEKLKKKH DFSKQGKTLT NTYLVTSGKR  900
NRKMNAASLD ILGEASEIAA AAQVDGRQLI SSGRISSGGR GDSRTSLGDD GIIERSSSFD  960
VIGGERETAA ADVLAGICGS LSSEAMSSCI TSSVDPAEGQ RDWRRQKADS VMRLPSTSDV  1020
TQNVDDDTCS DESCGEMDPS DWTDEEKSIF IQAVTSYGKD FSMIARCIRT RSRDQCKVFF  1080
SKARKCLGLD LIHTGRGNVG PSVNDDANGG GSDTEDACVL ESSSVNCSDK LCSKTDEELP  1140
SHVIHSNQEE SCSAGAKNLQ TDLNKLEDDN GITSLNDKDS EAVKPVKNDA FRTESRSFEL  1200
ESNNMNGMDN QSESVLDQKN AVELFKTAVR DKVAEQGALS VSAGEESDPC PSSSNAVEET  1260
NDVVAEASTE GFGNGLERYQ PMLLENSLND VRDKICNVDA CGESEIVQDS NTTGSAFGLY  1320
VDASSHSVSS KLDSVDKPPL ISLPQRNSHL AAASTQNSSV IQCKKVFIQD RMSSTLDLQR  1380
SKDKSDHKSV VSDDYRQHLS VHSIVNHIES PQILNGYPLP ISTKKEMNGD INCRQLSEVQ  1440
SISKSDRNID EPYLAQDCYL RKCNSSMPHS SVTELPFLAE NIEQTSDRRR AHSCSFSDTE  1500
KPSKNGDVKL FGKILSHPSS SQKSAFSSHD NGENGHHHKQ SSKASNLKFT AHHPPDGGAA  1560
LLKFDRNNYV GLENGPARSY GFWDGSKIQT GFSSLPDSAI LLAKYPAAFG GYPASSSKME  1620
QQSLQAAVVK SNERHLNGVA VVPPREISSS NGVVDYQVYR SREGNKVQPF SVDMKQRQEF  1680
LFAEMQRRNG FEALSSIQQQ GKGMVGVNVV GRGGILVGGG SCTGVSDPVA AIRMHYAKAE  1740
QYGGQGGSII REEESWRGKG DIGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D6e-14788874994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C6e-14788874994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436269.10.0hypothetical protein CICLE_v10030482mg
RefseqXP_006436270.10.0hypothetical protein CICLE_v10030482mg
RefseqXP_006485882.10.0PREDICTED: uncharacterized protein LOC102608361 isoform X1
RefseqXP_006485883.10.0PREDICTED: uncharacterized protein LOC102608361 isoform X1
TrEMBLV4VB500.0V4VB50_9R
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein